SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si038608m|PACid:19682816 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si038608m|PACid:19682816
Domain Number 1 Region: 6-41
Classification Level Classification E-value
Superfamily F-box domain 0.000000034
Family F-box domain 0.0063
Further Details:      
 
Weak hits

Sequence:  Si038608m|PACid:19682816
Domain Number - Region: 212-296
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.0706
Family DPP6 N-terminal domain-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si038608m|PACid:19682816
Sequence length 379
Sequence
MGDSPRLLPEDVLADILARLAPRSLAVSRGVCREWRAVVDARCNLLPISMGGFFILTNES
ETPEFFVRPSMAHKIAADLEHYLKMDHWYYPPDIADSCNGLLLLEDRVVNPATRQWVRLP
PYPALTETESRGNDRYLAFDPSLSPYYKVVSIKGPPYRKDERSEGLKWPPSVCTLLIYSS
STGSWEERPFVREGPTITIAANLWPFSDLGRSHGVYWNGALYVYWSGFSMRITLSNDTYQ
VLPLPTSIKTSEYYQPCLGKSKNGVHLVVVDDQKQLQVWFLDEFGGKMEWVLKHDAKLQA
VKLPKYTYRPWILQDGNYNDQETTNKELVQEKELDWDSDDDNDDGIGEWGEKCSCKSIEV
FGFHPYREIIFLLLRVCPS
Download sequence
Identical sequences K4AI99
Si038608m|PACid:19682816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]