SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si038619m|PACid:19680390 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si038619m|PACid:19680390
Domain Number 1 Region: 21-97
Classification Level Classification E-value
Superfamily F-box domain 6.8e-16
Family F-box domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si038619m|PACid:19680390
Sequence length 181
Sequence
MWCGEVYPLSSAGSAEEEVPAKRYPAASLTDELLVEILRRLPVRSVCHFKCVSRSWRNLI
SDPGHRKKLPQTLVGFFYQSLSGERFPCLAHHFTNVTGKGIPFIYPSFSYLPVYSSDVVP
LDCCNGLLLCHCFQSGPGDSDGLAAGLAARFALPAYPALSPHFHVIEYVEDESEYITGVD
I
Download sequence
Identical sequences K4AIA9
Si038619m|PACid:19680390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]