SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si038668m|PACid:19680010 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si038668m|PACid:19680010
Domain Number 1 Region: 2-57
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000929
Family F-box domain 0.0098
Further Details:      
 
Domain Number 2 Region: 385-424
Classification Level Classification E-value
Superfamily F-box domain 0.0000109
Family F-box domain 0.011
Further Details:      
 
Weak hits

Sequence:  Si038668m|PACid:19680010
Domain Number - Region: 562-727
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.000745
Family DPP6 N-terminal domain-like 0.044
Further Details:      
 
Domain Number - Region: 199-286
Classification Level Classification E-value
Superfamily Kelch motif 0.0017
Family Kelch motif 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si038668m|PACid:19680010
Sequence length 758
Sequence
MGGLPDELLEEIFVRLPAKSIGRLRCLSRSWAATLSWASFVDHHLRRANPAGQPKVFLVP
DASTAEADALYAWQAPGGSEIKKLMSLNTDTIPQPEMLLPLTKPCRGLVLLRCPPALSYY
VCNPSTGALLPVTDTRIDCSGAGHVSYGLGYSAATREHKLARLLCFVDQDGAPVATRCEV
LVLDASAHWRPSAGRPPVCVVSGEKAAVFLNGRLYFAGYGGEIVAFDVADETFGVLAHPA
EVYATVSPCLTELGGYLCVSHGLAGFGEPYTVWLLRDYEAERWEKLCCIDQSAWPDAELG
VTPVDVFHEEACERSKIMFRTGGCTLFAVDLERDGGVYPDVLLSPDSIDAMGVCGCRLGL
YEESLVTPGRTAEEIVFASPLAAAWSEVLKRLPARLVARLNLVCRDWRALIGADRFIHAQ
AVHAELNDAPRIMFSDCNNIGRFTALEDLINDGAPAGTPPLASHGSMFVCSQPCHGLVIW
GHASIGYYVCNPSTGRSNNLRVTFDDDLMDTSGEGEAAFFARRVGLGYDTVTNKHRLVCL
SYRHKSYATREYELECAVQNIRDGGAWCSVDPPPPRPVADAPPVDVGGKLFWTVDRELEP
PRPRGAGCEIVAMDNHTCDFEVLQGPPCSWDGELVSILELRGKLGAVCAHRSSNTLVIWT
MRDYGGGCSWSLEYSIEFGKSSPEYSCDTTVPLAIDPNGHRVLLSTGRSLGWYDPRTGAI
QTIYSLGTRRERGKNFVPVVYRESLFRPDGMRRLRAPN
Download sequence
Identical sequences K4AIF6
Si038668m|PACid:19680010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]