SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si038711m|PACid:19679780 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si038711m|PACid:19679780
Domain Number 1 Region: 29-88
Classification Level Classification E-value
Superfamily F-box domain 0.00000000916
Family F-box domain 0.0059
Further Details:      
 
Weak hits

Sequence:  Si038711m|PACid:19679780
Domain Number - Region: 104-367
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0102
Family Quinoprotein alcohol dehydrogenase-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si038711m|PACid:19679780
Sequence length 402
Sequence
RLRVTIEDDDGGETNGSAALVSPLENDDLIADSLLLLPALPSSLLHASLVCKRWFRVLSN
PRFLHEFCAHHRKPPLLGLFYCNWGRIIFTPMLDPPDEIPVRRFALEVPIGTNLLCCHHG
RVLMHDVGKQYFMVWEPITGKLCRISKPSSFSPYQMTLTAAAIVCASTDRGHIHGACHSD
PFQVVVVAGDSERFYGCVYSSETRAWGNLFWIMRPPQIRTTRATYGSQLFRNSICLLLIE
EKIAILEFDWSRQNLVIIDVPYALDFYDFFTARSQFLIKLSDGGGLSFVAQKVFTVHVWK
RTSDGDGVATWMLVNTIDLSSVLSLGLPEDLWMHLVILASDGDGNVLFRKTSSRVVYVVN
LESRKVKKLPKTYPFKVGHPFSSFYTPEWLSFPSLLNKKFAH
Download sequence
Identical sequences K4AIJ9
Si038711m|PACid:19679780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]