SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si038726m|PACid:19684698 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si038726m|PACid:19684698
Domain Number 1 Region: 5-57
Classification Level Classification E-value
Superfamily F-box domain 0.0000131
Family F-box domain 0.0065
Further Details:      
 
Weak hits

Sequence:  Si038726m|PACid:19684698
Domain Number - Region: 138-247
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.0112
Family Galactose oxidase, central domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si038726m|PACid:19684698
Sequence length 416
Sequence
MEKDLLHLPTDIIYKMLTQISDPASIVRAASSCKLWRHIIMGSTFLDGLKMRHLSHGFAP
SFLLGFFYQDNTQPSLHLWQRYMKKCYSLEPSFMPTSVLLPSTGRKEGSDVVRPLSLGTF
IEGFVASLNFYEPIASQDSLLVLCHRSKDATTLDVVRVFNPLTGEVFHIPDLPYYRPVPD
NYAVLVTDDVSFGGQMSRSFQLVVLWTTGNRIFYSYYCSKTRSCWKPSNSPEIMPGLFVV
SMVTHVVTLHVDGEELSYLELPSEAKGKMLLANSADGGVLLLILKDLQMSLWKHKSEPGS
DTSDWVSSQMIDMADYLPINTVLQSRAKVALEIFRGKSGAVVLWVEKEGLFLFSLSDWSV
RKLDNDRVTRKYRLCPYDMDWVSCLLVTNLVVDGSSSLDVGRKKVQGRWRTLMTKV
Download sequence
Identical sequences K4AIL4
Si038726m|PACid:19684698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]