SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si038766m|PACid:19684836 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si038766m|PACid:19684836
Domain Number 1 Region: 88-331
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.00000288
Family Galactose oxidase, central domain 0.052
Further Details:      
 
Weak hits

Sequence:  Si038766m|PACid:19684836
Domain Number - Region: 9-55
Classification Level Classification E-value
Superfamily F-box domain 0.0105
Family F-box domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si038766m|PACid:19684836
Sequence length 361
Sequence
MAAEPEAATTSPRCLDDDVVTEILLRLPSSSAVPSAWRRITTSPVFLAAYSHRCPLELIL
QRHGFDEELLDTIPLPTLDEARRRCLQVPYWRGYSLIGSCDGLLLFERGPGADHLVCNPV
TGQWTMLLPRFYLHRPSGEHRLLYLTYSRQESHHVYSLEAAEARRLGQAFPVDAFCSERP
FVCLNHRGKLHWQQRPLVLFSTDNMHMQHRGVEDASKIVAFDTELETFRRISPPPPLSNR
HEGALCLMEIDGELAVAAILKGSMDLWVLEDYNNDETWTCRLRVDLPPTLWHSRFVAVNA
GVEEVQNMILLVDGWSHSIWLYDLTERRVSKQIQFGGTRLNALAFRESLKRHAFFDRQDP
E
Download sequence
Identical sequences K4AIQ4
Si038766m|PACid:19684836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]