SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si038806m|PACid:19682341 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si038806m|PACid:19682341
Domain Number 1 Region: 8-55
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000314
Family F-box domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si038806m|PACid:19682341
Sequence length 408
Sequence
MAAHGPFLLPDDVLADILARLPRRSIGCFRAVCRAWNAIASSPSADRLFAKRPAAVTAIT
EKNRSLEVDDERRPVYIVRFDFFRGRWHPDVHSHKRGPCPRAVSLDDVTIAAEAFRSWDG
VLCTRVFPREPQPGAGAGAGADYMLWNPLTNACAVVSAPAGEGRIIGGYAHPATGRFHLL
HCSDVAVPRHRDLVAPITARILAVGDGTAWREVPLPSSLSMMGERDHSVSLHGNLHWLVQ
PAGSGKVALLVFDTAQEKFWVMAAPERPGLDPATARSRVVPGGKLCVLALTQQPPVALEV
WMLDDYSDTRSWRFRETVRLDSIRLPPRSDWPRWFAAAAAVEVVEGVHEGEEIFIQHEHG
IIAYSVRNKVWRNVSVGQSCAALLVHRESVMRPEISFGKALRVFRRRT
Download sequence
Identical sequences K4AIU4
Si038806m|PACid:19682341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]