SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si038819m|PACid:19680708 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si038819m|PACid:19680708
Domain Number 1 Region: 14-73
Classification Level Classification E-value
Superfamily F-box domain 0.000000000000419
Family F-box domain 0.0039
Further Details:      
 
Weak hits

Sequence:  Si038819m|PACid:19680708
Domain Number - Region: 183-247
Classification Level Classification E-value
Superfamily Kelch motif 0.00248
Family Kelch motif 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si038819m|PACid:19680708
Sequence length 384
Sequence
MSKRLVPHTCSPAADLLPDDVLLDIFLRLPPEPTHLFVASLICLRWRRLIRDPAFLVRFR
AFHRATPVLGFYQNIRDGSRCGIRFVPIADPAPRLSALKEYQNGACRVLDCRHGRVLICD
EVFESLFVWDPMAAESFDVGSLPEFSGEENFTAVLVCTPGHDDHTDCHSAPFRIVLVDNS
DDDEELLVSVCVFSSETEAWGEWTSISPPSLVSTDSAAVVGGFVYWMLGSDEDNYQDHIL
GFEMQTRRLDLIELPKEVQEKYKSDIHLMPAEDGGIGFAGVNLSSLHFWSRKTDNEGAAG
WALIRIIDMAMLPISHKLAGDMLLWSSVAGFADDSDVLFLHSEAGVFMINLRSKQLKEVP
QASDNAIYIYPYTSFYSRVYYFAG
Download sequence
Identical sequences K4AIV7
Si038819m|PACid:19680708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]