SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si038896m|PACid:19683376 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si038896m|PACid:19683376
Domain Number 1 Region: 24-77
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000249
Family F-box domain 0.0071
Further Details:      
 
Weak hits

Sequence:  Si038896m|PACid:19683376
Domain Number - Region: 114-190,222-257
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 0.00301
Family Soluble quinoprotein glucose dehydrogenase 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si038896m|PACid:19683376
Sequence length 394
Sequence
MSEDGSGRQGASSAAVPASPLEDDNLLSLILHRLPAVPSSLLRASLVCKGWRSLVSDPRF
LRDFRTYHKNSPLLGFFSGDLLGNVEFTTMLGSSDCIPASRFSLCLRPGSRFLCSHHGRI
LILDQEEQQFLVWDPVTGELGNIAFPPAFNGKMLFIIDGGIVCAATDQGHVHGACHSDPF
RLVFLGEDRERILACAYSSETRAWGNLFSIMRPPYFVRYNSPKCPSTLSRNSISLLLFGD
KAVILEFDWGKGNLALIDVPSDAYDFDAFIGGMCQFMIAHVDSGGLCFYLLSAFSVHVWK
RVCNSDGIATWMLEDTIELRNLLSLKPTMHLTILGLDEDNKVILKLTDSVVFMVSLESMQ
FKTLSTQLPFYSFSFHPFKSFYTPAVKPCCLIQS
Download sequence
Identical sequences K4AJ32
Si038896m|PACid:19683376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]