SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si038975m|PACid:19679055 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si038975m|PACid:19679055
Domain Number 1 Region: 29-93,122-150
Classification Level Classification E-value
Superfamily F-box domain 8.24e-17
Family F-box domain 0.0075
Further Details:      
 
Domain Number 2 Region: 421-464
Classification Level Classification E-value
Superfamily F-box domain 0.00000034
Family F-box domain 0.011
Further Details:      
 
Weak hits

Sequence:  Si038975m|PACid:19679055
Domain Number - Region: 333-384,710-760
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00208
Family Quinoprotein alcohol dehydrogenase-like 0.024
Further Details:      
 
Domain Number - Region: 138-294
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.0131
Family Galactose oxidase, central domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si038975m|PACid:19679055
Sequence length 775
Sequence
KTYTRTFTMDAADISKRIKVEGASGGCPLPEEIVEDILSRLPARSLCRFRCVSRSFDAVI
SSRAFQDTHYQRNSGDRRLFVRPPGVQEPFYAWHPCTGAGGPAETIMSPRRLPQGSTFPV
SKSCRGLVLLKNTEHCTHHVWNPSTGEILTLPDKEPLRARCLFVSYGLCYCPATQRHKVV
RLYNGPWGSIFDGYGAKPATICEVFTLNESAYWRPAATEPPPCHPRENYRQLGVFCDGNL
HFLDQCGGITVFNVEDETFGTLDPPPVLQRWSNFQLTELGGSLCIYSIVEEQWRSYRECK
HIVDVWLLKDYTAAAKWERLCCIDCGDAPEQVERQVMLKSSWIAPLDMYYDGSNQRKIVF
GTEHCNVFIVDPNNGTTKLAFTLAIGGRGRRPSMGFFEESLARVGTLSENTAFASPWMRA
WSEVLSRLPALADDVWSLNQVCRGWRAIIKSEHFVAAHLRRANPSGKSLQMVFFSDAGMP
YAFEPVGKYIDSPGIMPPLVDSRCTIICSKPCHGLNLLSLAYSDFVCNPATRYFKALPPD
DDIRHYAAMFTGRLGLGYEQESSRHVLVRLAYTEKNLTTRDYKMVCHMKYLEDIIWDEVD
PPPRPIANMLPAHVNGKLYWMVETELGQSSSGLEMIELDVSKRKFEVLKGPPCGRDSGEH
MSINELEEMVCVICSNRTVGIIRIWAMEDTGMWSAKYDIQLERFSPEYSPETTMPLAVDP
KDGRILLSTGRTLGYYNPKTAELETIYHLGKHTEGMKFVPALFQESLVNPCHYSV
Download sequence
Identical sequences K4AJB0
Si038975m|PACid:19679055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]