SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si038986m|PACid:19681217 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si038986m|PACid:19681217
Domain Number 1 Region: 7-80
Classification Level Classification E-value
Superfamily F-box domain 0.00000000183
Family F-box domain 0.0073
Further Details:      
 
Weak hits

Sequence:  Si038986m|PACid:19681217
Domain Number - Region: 98-255
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.00153
Family Methylamine dehydrogenase, H-chain 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si038986m|PACid:19681217
Sequence length 367
Sequence
MGPHERRGSASAWPDLPPELLERIVAVLGPRDRVAVRLVCVSWRACVRERFPSDLPFEAP
RLLLRRPGVGGGLAFFSLHRRKVLPFALPASVGAGRCCGHTGGWLAMAFDADRSMALCNL
VTGQSVAVPPPPVFPVSKVVLSGPPTSPCWIAAALGRTGTVALLQPAVSGAWMTIGVEEG
ARHGGFRDMAFWSGRLCALGYDGAVLAFRGDLRARAAAVSVLREADYPVDDLHGIWRRRR
DRLYLVESDGELLVVRKLYRVWGNGAVDAQVEVQVLLSAGERKWGLMDETPGRAVFVGSV
ASAVVAVELYPAAGLRESCVYLAQREVEMLAPHAICEYSMEEEEMRGVPIAGGHSADVEP
VWIIPFV
Download sequence
Identical sequences K4AJB9
Si038986m|PACid:19681217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]