SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si039016m|PACid:19679400 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si039016m|PACid:19679400
Domain Number 1 Region: 110-356
Classification Level Classification E-value
Superfamily Kelch motif 2.88e-43
Family Kelch motif 0.0015
Further Details:      
 
Domain Number 2 Region: 44-97
Classification Level Classification E-value
Superfamily F-box domain 0.0000139
Family F-box domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si039016m|PACid:19679400
Sequence length 416
Sequence
VESVSCYCRVDGGLKTVVSARKFVPGAKLCMQPDIIPNKRKSRSSRKERSQTQSPLLPGL
PDELAISCLMRVARVGHPNMRLVCKRWNRLLSANYYYSLRKKFGMAEEWVYVFKRDRDQK
LSWYAFDPVNQLWKSLPPVPPEYSEVVGFGCAVLNGCYLYLFGGKDPVHGSMRRVVFYNA
RINKWLRAPDMLQKRHCFGSCVINNCLYVAGGECEGIQRTLRSAEVYDPNRNRWSCIAEM
STGMVPSIGVVHDGKWFLKGLNSHRQVVSEVYLPASKMWSATGNEMVAGWRNPSISFNGR
LYSSDCRDGCKLRVYNREAGSWTRFIDTRHHLGSSRALEAAAFVSLNGKLCIIRNNMSIT
LIDLSDPTTVIEVDSARMWDAFARKGQHRSFMANLWSTITGRNLKTDIMHCQVLQV
Download sequence
Identical sequences K4AJE9
Si039016m|PACid:19679400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]