SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si039062m|PACid:19683316 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Si039062m|PACid:19683316
Domain Number - Region: 25-71
Classification Level Classification E-value
Superfamily F-box domain 0.000183
Family F-box domain 0.0091
Further Details:      
 
Domain Number - Region: 100-161,226-324
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 0.00562
Family Tricorn protease domain 2 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si039062m|PACid:19683316
Sequence length 435
Sequence
TYGDSRMAAPLPTSATLFPDMSAASPWASSLPEDLVRLVASRLLAGDLLDYVRFRAVCAP
WRSSTASPRGRGVVDPRFHPRRWMMLSEGGGLYPGHPKLQGYVRFFNLDTGAFVRVHMPL
FEDHCVLDSFNGLLVLQRDDDTAIRLLHPFTGDILDLPPLKTLLPQMHEVFPHLSSRKKL
PYLRSISTAATFADDGVVTVMLALRRTRRVAVATSQDHQWTMSTWYYVINRAPFPYQSKI
YVVHDLGGDHSAKIFQIDTPLPGEVLQPPKLIVKSTADKLRGPVFLVECDSEVLVIGYSK
NLSSKLLVYKLADIVMEKYTPMTSIGDKAIFLQQRTLSASAKALPTLVGGTIMYFHPREH
QLVQYHLSSGSWSPAMDQCSLRGTEPGPCSFIQHIYTCCSCKHWNKGLMCRWWKYPAEWI
RWPVKGKLRQGVIDS
Download sequence
Identical sequences K4AJJ2
Si039062m|PACid:19683316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]