SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si039066m|PACid:19680922 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si039066m|PACid:19680922
Domain Number 1 Region: 50-112
Classification Level Classification E-value
Superfamily F-box domain 0.00000000288
Family F-box domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si039066m|PACid:19680922
Sequence length 351
Sequence
MPPRRRARLSSRPYSAVAAAEPCPRGWLAVRRSRPSKRARRVVTTIPQGDGDDDGTPLTD
EILVGIFAGLPDFSDLVRCAATCRRWCRLVSGEAAFICRAKRCWTPPSPLIRSLALGFFY
SPRHGAAPRFAATASASRRLGLRQPSLNALIQGLDDGLFDASRLVASRNGLLVVELQRRK
RERALKLCVCNPMTGEVTVLPPLGGKEIVSPFACTVLTADDYYNNDDKTCGTAPASPSPP
PCAPCHHCPCPGSEPRRRWPLHRTARRSPRRVSRTPAWPPPQPRSSRFAAPRSRIPLLLL
EIGQDTQCGAALLSHLLPDADAEASSPAPHHRAKGKAKLGRKRERGKEVGA
Download sequence
Identical sequences K4AJJ6
Si039066m|PACid:19680922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]