SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si039102m|PACid:19680565 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si039102m|PACid:19680565
Domain Number 1 Region: 55-105
Classification Level Classification E-value
Superfamily F-box domain 0.000000144
Family F-box domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si039102m|PACid:19680565
Sequence length 409
Sequence
MKERWAVSAPPSTKKALALRARATPPRKRRRAFISPPSPDQTQTTPQRPPETEEAEPPAP
TLPYDLLPEIAARSDVTTLVRCAACCKALRREILRPAFIRRVCREPASGAVVPPCALGFL
HAYDKARMEAEQDQPPPAPCFSVAHPACGVLLRGAPRAVRGPYLGGDRSSEMCVYDPMSG
DRTFLPSPPYGMRVSDRKASDYGVSYTYVLLTAADGVGGGSFHVLAADFSGLMLHSANIM
VQTVSSDNAGDGACAWGPVTMAAHPRSRRSYLQPHCGAVVLCGLIHWLMYDYYGQFHILT
YNARTAMAGSIELPKGSLPDHCKVSNLHLASSPDGRLSLHVADKRRYQFGCCGLPVPPAT
VGGGSEGEQDLAVLDVETKELRRVIKKKNITAFPYEIDLEARLSAMKTF
Download sequence
Identical sequences K4AJN1
Si039102m|PACid:19680565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]