SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si039155m|PACid:19681343 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si039155m|PACid:19681343
Domain Number 1 Region: 21-62
Classification Level Classification E-value
Superfamily F-box domain 0.000000000876
Family F-box domain 0.0033
Further Details:      
 
Weak hits

Sequence:  Si039155m|PACid:19681343
Domain Number - Region: 180-297
Classification Level Classification E-value
Superfamily Fucose-specific lectin 0.00575
Family Fucose-specific lectin 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si039155m|PACid:19681343
Sequence length 440
Sequence
MLLRSGKRLKRAPGGGHDDDDDGLPLADEMLILIFARLLDTDDLVRCAATCRRWRRLVSG
EASFICRSNPEQFVPVGFFNQGEEYGVMDVPRFVPLASHFPSASVNALFADEPFRSSRLV
TSRKGRLVLELCPRVCNPMTGNVSVLPALAGRDNPGRYACALLTADDLTNAADPPGSASS
FRLVIVYDRRDFTACRTYSSDAGSWSPEGIVSGARVSGRSLAQAHAAAAAVARGAVFWRV
RDAVLVLRLDSTLEAALEPLPEDWTRGGRRGYGPGVLAVSPDDGRLCVVEARIHDDYYWK
HEVKVRVMFREHGGGGEDDVAVPGEKWVASRGTTLQLQAPSGCYGRMTRVSLRGVCEKSG
VVFLAAVFESRPNRETPYALDLGRMEARLLRGVPDVGCRLGSCASFHGYEMDRLAYVTSL
GKRRGKGMITMDVDDIYDFY
Download sequence
Identical sequences K4AJT3
Si039155m|PACid:19681343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]