SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si039300m|PACid:19682169 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si039300m|PACid:19682169
Domain Number 1 Region: 12-60,106-127
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000275
Family F-box domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si039300m|PACid:19682169
Sequence length 330
Sequence
MDSTKKSASAAAHLTDDLIVEILSRLPAKSVCCFKCVSWHWYGLITNPEHRKKIPQTLSG
FFYRSCRLNHEKDMIIFPDFRHGQRRPFSDPSLTFITGYKLIIPKICCNGLLFCLCWKVY
PRDESDYVVCNPATEKWVVLPDSDHDSSACAYRLFFDPAISLHFHVFQIIEEDEDYMGTS
LGKTWRTIPLLETMRVENFCRGPFSFIGQSQGLLYYINMRDCDTSKLSVRILEDYDGDEW
LFKYSISTTHIFEEKNPMFDRDYCLIAIHPECNLIFFVWRCEEDMHMLVSYDMDHGKVCV
ICSLKEFFYDEFLPYLPYVPFLSGSLPGHS
Download sequence
Identical sequences K4AK77
Si039300m|PACid:19682169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]