SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si039371m|PACid:19684602 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si039371m|PACid:19684602
Domain Number 1 Region: 9-109
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000085
Family F-box domain 0.0077
Further Details:      
 
Weak hits

Sequence:  Si039371m|PACid:19684602
Domain Number - Region: 128-304
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.0235
Family Galactose oxidase, central domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si039371m|PACid:19684602
Sequence length 355
Sequence
MATPPPRHRRPTPELFDELIEEILIRLAPYKPELLIRCSAVCKPWRRLLTGPAFLRRYRV
FHGAPPMPGFLINVELPDYSVFARFVLATSFRPLTTDHDDWCAHDSRHGRVLFHDPRSPH
PEFPDPEILVWDPVTGARWELPLPPVPCCYSVTAVLCAAAAREGGGDCDHLDCHGGPFLV
AFLGTTLGGLTFVCVYSSEAAAWGDAIYAEGEHPDALDDMDMRPSALVSNTIYFISSQSK
AIVGYDLGRRQLGFIDPPFAAEGYAFLMPLVGGGLGFAGVSGTCLYLWSREAGPDGTAAW
TRRRAIELDARPTGGLAGFAEGLGIIFSGRVTKVSIRKNVDTVIPYRSFYTPGNL
Download sequence
Identical sequences K4AKE8
Si039371m|PACid:19684602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]