SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si039478m|PACid:19684835 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si039478m|PACid:19684835
Domain Number 1 Region: 6-46
Classification Level Classification E-value
Superfamily F-box domain 0.000000000484
Family F-box domain 0.0073
Further Details:      
 
Weak hits

Sequence:  Si039478m|PACid:19684835
Domain Number - Region: 87-141
Classification Level Classification E-value
Superfamily Kelch motif 0.0288
Family Kelch motif 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si039478m|PACid:19684835
Sequence length 339
Sequence
MAVGRELPDDLIADVVRHLPPHSLAVSRCVCRAWRDLVDARRLLRADLLPRSVGGIFMNY
RALYSPEFFSRPTTGPSISGDLGFIPGFSTVVDHCNGLLLVTETSDDYVANPATRRWARL
PPRPTSQMGEACDQIECLVYDPTVSPHYNIDPEMMQSEWPPSSLQVFSSITGCWEERSFA
LEEGSWDLEERLFVSERGRMVRIITHTKVYWREALYVLCKNGFVLSQQHKGPWILQDINN
YKYPYDNGLQREVVDDNFEWNSDDDNVLNTDDMVEGHFEGYTGLLGFHPYKEIVFLNSDL
YRVVAYHWNTSKFQDLGNIFPKEYLEVAGHCAGINTSFT
Download sequence
Identical sequences K4AKQ3
Si039478m|PACid:19684835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]