SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si039492m|PACid:19679156 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si039492m|PACid:19679156
Domain Number 1 Region: 12-60,91-130
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000000667
Family F-box domain 0.0079
Further Details:      
 
Domain Number 2 Region: 123-254
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.0000124
Family Galactose oxidase, central domain 0.027
Further Details:      
 
Weak hits

Sequence:  Si039492m|PACid:19679156
Domain Number - Region: 217-357
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.029
Family YVTN repeat 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si039492m|PACid:19679156
Sequence length 384
Sequence
MDHSKKRASATADLTDDLIVEILSRLPAKSICRFKCVSWHWYGLITNPEHRKKIPQTLSG
FFYRSYKLNHEKDMVIFPDFVGIMGDEEQPFSDPSLTFITGYKLIIPKICCNGLLFCLCW
KVYPRDESDYVVCNPATEKWVVLPESGDESIALVYCFGFDPAISPYFYVFQITDEDDDYG
YIDGVNIYSPETGAWSRNKNGWGNELHLVDRGAVFLNGMLHLLTYDFKILAVDTQGKRWR
TIPLLETMTVSCFWKGPEAFIGQSQGLLYYINMRAGDTSKLSVWILEGYDSGEWIFKYSI
NTSQIFGEKDLMFERDYALIAIHPECNLIYFVWRCEDMLMSYDMDRGKVCVSSLKEHLYD
RPFLPYLPYVPFLSDSLSATRLGT
Download sequence
Identical sequences K4AKR7
Si039492m|PACid:19679156 XP_004983927.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]