SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si039515m|PACid:19685227 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Si039515m|PACid:19685227
Domain Number - Region: 4-62
Classification Level Classification E-value
Superfamily F-box domain 0.0589
Family F-box domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si039515m|PACid:19685227
Sequence length 246
Sequence
MASRRQCLLLTDLPMEVLIIIASDVAVTSYKPMEDLGNLRAFCRVMEFACGDPSVGQHVA
MLRIYMEGFKWLNPDRYYNLLALMVGVANPQACTLKGIADFFTGTNPSLNEVSCAAAGGH
NVGAYLYALMLYMNNAGAADDDIAKMYIHRLECKDDSVAIGSAGPKKLRNNGCQVCREEA
TYLVNSVTWHMHGEPLPPAPVRGDFPCAQGDCGKVKGREQATQFCNEDSRIHHEIVEFKK
RMGIDQ
Download sequence
Identical sequences K4AKT7
Si039515m|PACid:19685227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]