SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si039616m|PACid:19684224 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si039616m|PACid:19684224
Domain Number 1 Region: 156-238
Classification Level Classification E-value
Superfamily F-box domain 0.00000000192
Family F-box domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si039616m|PACid:19684224
Sequence length 342
Sequence
MATFLHKFVDAEQWEAEDDVGRLGLVAHAAFLHAGFLPYGAKPRSGQLMKQAGDTGSSSF
LSRRYTAPELAHRDSAETAVLMLCKGEGGDFALFMYLTTDRDMRRTYRQRLDAAAMAPLL
SRSLDDTDPWGSRFCRWLADGACWGLLVELCRRNGLPLTVFTSLPEDVVVEILKRVGDGA
ALARAACASRLLRRLVAAYDVELWKPLYEAAVGVGEELYMMFFFPKLSEGFISWKWRCAK
VLQLKQLFSRPIATTPPIQSNPRNARGKRGERRCRHPNVPLHDDYGTKRQDSGDVQSPER
IATEKSAEGHRHKVPRYDWNRKRRHVAGAIHSPSSRYRWNHR
Download sequence
Identical sequences K4AL37
Si039616m|PACid:19684224 XP_004986730.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]