SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si039688m|PACid:19680224 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si039688m|PACid:19680224
Domain Number 1 Region: 33-91
Classification Level Classification E-value
Superfamily F-box domain 0.000000164
Family F-box domain 0.0089
Further Details:      
 
Domain Number 2 Region: 212-398
Classification Level Classification E-value
Superfamily RNI-like 0.00000373
Family Cyclin A/CDK2-associated p19, Skp2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si039688m|PACid:19680224
Sequence length 479
Sequence
MESSKDVVVHDAKRAKLRLATADHHGGTAAAGWQKDLISGLCDDVLLRILGLVPDATDAV
RTGALSRRWRGLWTRAPALRFTLWPRNRICWPHRLDNAERFIAFASNVLALRAQQSGDAA
IEHLKISFPFDFEGDTDQLLRLQSIRAAETWIRCAAQQSVKSFCFDQRLPRRPIPAAENG
DEEDEDERDEGPDVMVLDDLPSSEKLETMSLDLDGGCRVRLPSAVVFASLVDLTIKFMKV
AAGSGHLLARLLSSDCCPSLQKLCMWFVRLPSGMNELLLENSSLLELTLDDMDDMSLIEL
RTPSLRVLEVKECMDLEVLVVSAPRLEELMFLENSSQKEDVHNIDIIKGRIPHLDHVTSL
NVHISPLKRHSFGDYVARLLSLFRNLAYLCLDFDTYIKPDDQCLGSDFICDHLDHWKSYE
ISSLHLQKAEFRGLTGTDCELHFFRSVLASARQLQMNMLLGGGTWSDCHWSYERRPCQR
Download sequence
Identical sequences K4ALA8
Si039688m|PACid:19680224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]