SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si039692m|PACid:19679795 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si039692m|PACid:19679795
Domain Number 1 Region: 9-49
Classification Level Classification E-value
Superfamily F-box domain 0.0000113
Family F-box domain 0.0045
Further Details:      
 
Weak hits

Sequence:  Si039692m|PACid:19679795
Domain Number - Region: 160-205,248-342
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.0687
Family SGL-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si039692m|PACid:19679795
Sequence length 387
Sequence
MACGGGGRGGTGWSSLPADLLLAVFALLPSDADRSRFRAVCAAWAAAAAAWRPGPWLVGS
RTDRAGRGGGAVSSFWLSPTPGAGLLPFAANVPAGLEYLSSSRGYLALSDPTASPKAIVL
VNPVTGRRVRLPPIAFFKRWLDVTTSCCPPTRPPLQSGRRWRSTTGAWARLDFRAQGYAG
VEHYNGRFYVAFRSQICVCEVVGGDATAVIPLERADGADDGDGSDDEKLLPPCGRRVVET
HLVDCGGQLLLVSVHDDVVYNSDDDMAGLAVDDEGISYAGDARAVEVHRVEWLGDGAVRL
VRVADLGWNALFLGRNRAFALSPAEFPACRANCIYLVDRQGHPDGVVRVVDMESQWARRE
ETICPDDGPRGSSSAGWARRGWFFPNY
Download sequence
Identical sequences K4ALB2
Si039692m|PACid:19679795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]