SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si039833m|PACid:19679266 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si039833m|PACid:19679266
Domain Number 1 Region: 176-378
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.000000157
Family SGL-like 0.054
Further Details:      
 
Domain Number 2 Region: 109-156
Classification Level Classification E-value
Superfamily F-box domain 0.0000017
Family F-box domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si039833m|PACid:19679266
Sequence length 458
Sequence
RRVVDVDIHVKPRSKDTWESVDNIGGRAIFIGGHNSSLVSNAAQAKLQPNCIHVLGMPRD
GGIPLYTIVLDDMSISFEQESSKDNAGAVSCEVSGTKLVDEKQGGQKESGDHVSSTSLWS
SLPRDLLELIVQEVTFMDYLRLPAVCKGWSGLTRSTPIHDAKSPLLLTTRARTQGRLATF
NPMTRKKYDLGIYVSSGDPEPQVLRCSKRGWVLVTEGEGYVSMMNPLKGVILCLPPMDND
YFSGITFISEPGSPDFMVVCVSDWRGLGTMTVRTWRNDDEDWTVTESEYQVPFLFPTASH
NPVLFDGEFYCLGRDGRLGVFNPNKMTWRVLAKPEPLYDATSMDQNEQRYLVVWKEQLIA
IFTVPHGEPMRTFRLDRSQMAWSELEDLSDVVLFMDSRNVLARPATREDLGNRIYVQSFA
ETDGAATAVFYSVKKRQYCPASYGNIEPVNSIWFEPNL
Download sequence
Identical sequences K4ALQ1
Si039833m|PACid:19679266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]