SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si039944m|PACid:19683023 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si039944m|PACid:19683023
Domain Number 1 Region: 10-56
Classification Level Classification E-value
Superfamily F-box domain 0.000000157
Family F-box domain 0.013
Further Details:      
 
Weak hits

Sequence:  Si039944m|PACid:19683023
Domain Number - Region: 110-209
Classification Level Classification E-value
Superfamily Group II dsDNA viruses VP 0.0119
Family Adenovirus hexon 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si039944m|PACid:19683023
Sequence length 383
Sequence
MEAHGPSLPPDDVVAEILARLPPRSIGRSRAVCRARNAIASHPSVDRVLANRPAAVTAIM
KSSGSRWLEVVDGHSPVDVIRFDRFRGRWHPEVHKTEPSPRALSLDDMTISAEVFRSWDG
VLCTRVFPRKPPQLGAGADYMLWNPLTGAWPSPDHRGYAHPVTGRFHLLHSSDMAVPGDP
DLVSPTTARILAVGDGTGWREVPLPMSKNISSMKSEGDRSVRLRGNLNWPVQLGSGKAAL
LVFDTAREKFRIMAAPERPGLDPTTARSRVVPGGKLCVLALTKQPPVALEVCGWRFRETV
RVDGIRVSPRMFAAAAAVEVVEGVHEGEEIFVQLEDGIMAYSIRSKMWRKVSVNWCCAAL
LMYRESVMRPEISFGKALRGFRC
Download sequence
Identical sequences K4AM09
Si039944m|PACid:19683023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]