SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si039982m|PACid:19680228 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si039982m|PACid:19680228
Domain Number 1 Region: 48-104
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000196
Family F-box domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si039982m|PACid:19680228
Sequence length 282
Sequence
MIQFSISWNSIQCAASAPSAGRLISAKASHMEGSSEPTMKDGDIGAPALPTEVLTEIFAR
LPSKSVGRFRCVSHAWCDTLTSPYFVELHYRRANQLVHPRLLLTPVGASYDSHLYSWRLG
MHSVEKLMPEKFPDGAAVPLTKPCCGLILIRCAHKGGYFVFNPSTGAVLPIPDIRAPLKR
IFQISYGLGYCTVRKEHKVVRLFSNAEGGNGMTPTSCNCEVFVLDKPAYWRPSAAQPPLC
SAMEKDPAVFIHGHLHFICSDGGGMTTFNISDETFGSLSPPS
Download sequence
Identical sequences K4AM47
Si039982m|PACid:19680228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]