SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si039994m|PACid:19681622 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si039994m|PACid:19681622
Domain Number 1 Region: 7-57
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000432
Family F-box domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si039994m|PACid:19681622
Sequence length 378
Sequence
MDMLPSSPLPADLLLEVLARCDPATVIRCAATCKPWYRCITDPSFPRLLRAHTGGGRSVT
CLVGGFFWRSREDDRCTFTETRMSPSSSCSAATTSPVAKTIRAFLSRNAGHLKSFEPWTR
RVVGHATGTSPVDMQVCNPVTGWRRSIPAPAVYDQAHVLLPGEDSHSFQLVAMDGGGAWD
PEIELSPPEDFERVVTPSPVVLGRVAHWLFRACGAYNVLALDADAARAACIDVPPRSALD
SDAIPRKQMLLSSTADGRLSLLAGEETRISAWALSTATTTTGGSSDSGWSLHATYEREWI
ARFVAPQGPRRKPGYPVIDLERGGGGGAFIGAQGFGSYVLLNMGTNEIVRTEVAKSSCFC
PYEYEVDLALLTAPMKSF
Download sequence
Identical sequences K4AM59
Si039994m|PACid:19681622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]