SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si040006m|PACid:19679094 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Si040006m|PACid:19679094
Domain Number - Region: 6-41
Classification Level Classification E-value
Superfamily F-box domain 0.00746
Family F-box domain 0.0095
Further Details:      
 
Domain Number - Region: 155-213
Classification Level Classification E-value
Superfamily YWTD domain 0.011
Family YWTD domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si040006m|PACid:19679094
Sequence length 387
Sequence
MWERDWASLERGLLHDVFTRLPADADAASFRHVCRGWRTAAGPGALVPGPWFVLQSSAAG
GHGAFVRPAGRRRVKPVRLDAAKAPVCASRGWLAVEDGGRLLLREPISRAEFPLPDFEDP
EYQDYQLSDIFLSDDPLDAPGRWVAFAFFKMKHVTYAGHVLAFCRPGDGEWARFDLDGQY
AGFYWGLEFFRGRAYVLVGISCRIAVCDVDARTLVASSVTLEHVMEWPWRDAQVHLVECG
GDLLAAAVSHYEDRMPPSCCARLRRQPRTVGVRVVKVEFAAGGGGAMPVALSDVEGTGDY
ALFVAPRGHAFALPASGFPAVRPSCVYHFDTNMTTKSASGMIITDLLDHTPHQHRPLRKL
PLAGKWHPLSWFRPRCPSFDTTPARRR
Download sequence
Identical sequences K4AM70
Si040006m|PACid:19679094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]