SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si040041m|PACid:19679589 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si040041m|PACid:19679589
Domain Number 1 Region: 12-112
Classification Level Classification E-value
Superfamily F-box domain 0.0000206
Family F-box domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si040041m|PACid:19679589
Sequence length 307
Sequence
MGQGCSNTPSTKSIPADALAEILLRVPPHPTCLARASLAGKGLRGVITSPDFLRTNFLPI
GGSSNRVSAAAFDPMEPGWRVVDSRHGRVLLRSPDRLRFLVWEPMAGRRRYIDAPPPHHV
EHYKFSNAALVCTTAHEEGHGNCHDCPLSIIFVVTPRRAGTTVATGDFSPLMITERPVVL
LQNVLYWTMAGVMGSQEGILSFELEAQRLYLIGQPAYIFDPEREHVQVMKVEDGKLGLVA
ACGLSLQLWGLVEYNGEGRERWLLDRETYLDADMAPPEPIFEDYYVIWILGVEGSIVFLR
TEAGIFE
Download sequence
Identical sequences K4AMA4
Si040041m|PACid:19679589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]