SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si040052m|PACid:19681132 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si040052m|PACid:19681132
Domain Number 1 Region: 6-38
Classification Level Classification E-value
Superfamily F-box domain 0.000000157
Family F-box domain 0.0089
Further Details:      
 
Weak hits

Sequence:  Si040052m|PACid:19681132
Domain Number - Region: 79-254
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.00353
Family Galactose oxidase, central domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si040052m|PACid:19681132
Sequence length 379
Sequence
MEGPPGSLPDDVLADALARLAPRSLAVSRCVCRDWRAVPEAAPEFFARPSMTRKIAGKLE
SYVRMEKHYNTPDIEDCCNGHLLLLEEHVVVNPATRQWARLPPCPSTTSPEGADEGSGGF
YDVYLVFDPTSSPHYKVLSMKNPLDYKGKVSKGSGWPPSVYMMRVYSPETRRWEERPFVR
EGGPLETTANVRASMGHATYWHEALYVHCTADFIMSGVYLALLDDQHQLQVWFFDEFGGK
IEWVLKHIIHPRAMIAHFIKNRAQTDRPWIMSRDDNYDQEDNEGPIVEKILDWDSDDDNA
VEIQDPDANCFYGYNQIFGFHLYKEIVFLRLSSSRVVAYHFNSKKIQELGKLPMKNHHHE
IDTTFIYTPCWTGELSEYC
Download sequence
Identical sequences K4AMB4
Si040052m|PACid:19681132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]