SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si040120m|PACid:19684707 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si040120m|PACid:19684707
Domain Number 1 Region: 5-59
Classification Level Classification E-value
Superfamily F-box domain 0.00000000981
Family F-box domain 0.0071
Further Details:      
 
Domain Number 2 Region: 98-168,220-344
Classification Level Classification E-value
Superfamily NHL repeat 0.0000011
Family NHL repeat 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si040120m|PACid:19684707
Sequence length 378
Sequence
LENEDLLADSFRRLPALPSSLLRASLVCKLWGRVVADPRFLREFHAHHRKAPLLGFFSRD
RDSAGRVEFSPILDPPDRIPASRFSLQITRNSRVLHCRHGRLLIYSPEEQRLLVWDPVTG
DLRRLALPPALDGKAIIDGGVVCASTEQGHVHGACHSDPFQVVVVAGESARYYGCAYSSE
TRTWGNLLSVQRGLGGLIPSPTCPSTMFRNSICLLLIGIKPVILQFDWARQNLALIDTPL
DAHDFRAIFCGDQQVLITSADNGGLSFILLEVFSVQVWNRTMSHGDGVATWILGKTIELH
KSLPLIGPTGLLFILGLDEDGNVLFKLTDGNLIMIVDLESMKCKKLPQEMDYVFCTPFSS
FYTPGKHKTYTMQLQQTR
Download sequence
Identical sequences K4AMH8
Si040120m|PACid:19684707

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]