SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si040137m|PACid:19680233 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si040137m|PACid:19680233
Domain Number 1 Region: 4-63
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000000654
Family F-box domain 0.004
Further Details:      
 
Domain Number 2 Region: 107-239
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.0000288
Family Galactose oxidase, central domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si040137m|PACid:19680233
Sequence length 331
Sequence
MDVDDIVEEILCRLPPDDPASLARAALVCKRWYRLVTDPHCRRRFRRFHRSAPMLGVFSD
GAIINGRFFVSTTSFRPPSRRDFVRDARHGRVLLQESWPRRTGFVGLVVWDPITNKQRQL
PDLPRQWLQHDTLNWNTAVLCAATADRTCDHLECHHGHFLVVFVASTFELVQTCVYSSKS
GAWSNHSSALLGGCRGVTLGPCALVGSALYFDTPDKSILKYDLGTNKMSLIGVPSECWHS
RKVPTAMEDGGLGFACLDTLLHVNAHPTSMVVSGFAGSVGVIFVHTHGVCFMINLNSNRV
TKLFRGVNVNGIFPYISFCTPGTGVPCLSVV
Download sequence
Identical sequences K4AMJ4
Si040137m|PACid:19680233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]