SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si040155m|PACid:19684140 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si040155m|PACid:19684140
Domain Number 1 Region: 47-96
Classification Level Classification E-value
Superfamily F-box domain 0.000000131
Family F-box domain 0.0081
Further Details:      
 
Weak hits

Sequence:  Si040155m|PACid:19684140
Domain Number - Region: 176-303
Classification Level Classification E-value
Superfamily RNI-like 0.00549
Family 28-residue LRR 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si040155m|PACid:19684140
Sequence length 491
Sequence
MEAAAPGAKKRRAEAPETGTSSTPATAATDTPTPEATPIKKTGEDGGVDRISGLPDAILG
DIISLLPTKEAARTQVLASRWAHLWRAAPLNLDCRDLPEADDEVLAGVVSRILSAHRGPG
RLFRVPAHHVHDRAATVDAWLRSPALDNLQEIEFCDHRRPAPEQPPTPPASLFRFSATLR
AATICRCHIPDGGPVQGIRFPQLQQLGLVRVRISEGSLHSMISRSSFPALEYLFLDSSHG
FRCVRINSTSLRSIGVRTDYYGQDLRFQELVIEDAPCLEKLLCAQRVGFHVSVMAAPKLE
TLGSLSNWPSKLSRSRHVFGSTVFQGLDLVSFTSAVRGVKILSVDLLIGNLDMVIGLMKC
FPCLEKLYVKGSISGRREKNLWRRKHRHLIQCFDSHIKTLVLENYEGIKSHVSFASFFLL
NARELEFMRLEVAQKNCNEEFFAEQRVKLQVEGRACRGARLDFALNRCHCRIIHIDHVHD
LTIADPFECTC
Download sequence
Identical sequences K4AML1
Si040155m|PACid:19684140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]