SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si040203m|PACid:19683302 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si040203m|PACid:19683302
Domain Number 1 Region: 9-65
Classification Level Classification E-value
Superfamily F-box domain 0.000000000654
Family F-box domain 0.0052
Further Details:      
 
Weak hits

Sequence:  Si040203m|PACid:19683302
Domain Number - Region: 88-179
Classification Level Classification E-value
Superfamily ClpP/crotonase 0.0315
Family Biotin dependent carboxylase carboxyltransferase domain 0.043
Further Details:      
 
Domain Number - Region: 89-347
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.0942
Family Methylamine dehydrogenase, H-chain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si040203m|PACid:19683302
Sequence length 370
Sequence
NDDLVADSLLLLPALPSSLLRASLVCKRWFRVVSNPRFLRAFRAHHRKPPLLGLFNCNSG
RIVFTPMLDPPDEIPVGRFALKVPLSTKLLCCHHGRVLMHDVVEQYFSVWEPVTGELCHI
SKPPSFVPYKMTFTDAAVLCASTDEGHVHGACHSDPFKVVVVAGDSERFYGCIYSSETRA
WDSFLSIMWPPHIRIIHGTCGSQLFRNSICLLLLGEKLAILEFDWARQSLAVIDVPYALD
WCNFMSGRTQFLIKPSDGGGGLSFVVQEFFTVHVWKRASDSDGVATWMLGNTIELNSALS
LGPPADLRMRIVIMESDDDGNVLFKKSNSPDVFMVNIESRKVMKLPKTYPFQDGHPFSSF
YTPGKYVCTL
Download sequence
Identical sequences K4AMQ7
Si040203m|PACid:19683302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]