SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si040246m|PACid:19684821 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si040246m|PACid:19684821
Domain Number 1 Region: 2-68
Classification Level Classification E-value
Superfamily F-box domain 5.49e-17
Family F-box domain 0.0073
Further Details:      
 
Domain Number 2 Region: 225-353
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.00000327
Family SGL-like 0.068
Further Details:      
 
Weak hits

Sequence:  Si040246m|PACid:19684821
Domain Number - Region: 172-212
Classification Level Classification E-value
Superfamily PHL pollen allergen 0.00353
Family PHL pollen allergen 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si040246m|PACid:19684821
Sequence length 374
Sequence
MEEPPGKRNPPASLTDELLVEILRRVPVRSLCRFKCVSRSWRYLISDPVHRKKLPQTLVG
FFYHSWNLERCPARAHHFTNITGKGAPFIFPDFSFFPVPSDHVRPLDSCNGLLLCRCLEP
GPDEGDGYPPFHYAVCNPATKKWVMLPDGSWASGEARTARLGFDPVVSSHFHVVEYVVDD
GDCVIGVEIYSSKTGAWSFMESEWGNDVMLDDEARSVFLNGFMHMVTYAAGIVVVDMEGK
TWRSIPVPSECDFGCIHQSHQGRLCFLNNDDVDASKLLIWILEDHGTHEWTLKHSVRKFF
LFRRKNLAYDMGYRVITFHPECNLIYFVYGWDRTLMAYEMDRKEVRVIRNLGHESSDPYL
PFVPLFSEALADEQ
Download sequence
Identical sequences K4AMV0
Si040246m|PACid:19684821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]