SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si000647m|PACid:19678243 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si000647m|PACid:19678243
Domain Number 1 Region: 305-407
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.49e-18
Family Ankyrin repeat 0.0015
Further Details:      
 
Domain Number 2 Region: 79-112,142-223
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000863
Family BTB/POZ domain 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si000647m|PACid:19678243
Sequence length 639
Sequence
MEPSSSITFASSSSYLSNGSSPCSVALPPPGPPQAPPLTAGDGWGSGGAAGGSSSNVEAV
SLNRLSKNLERLLIDEDLDCSDADIEVPDGGPPVPVHRCILAVRSPFFYDIFAARGRGGA
ARGDAAAGARGAGEGAASGRPRYKMEELVPGGRVGREAFQAFLGYLYTGKLRPAPLDVVS
CADPVCPHDSCPPAIRFAVELMYAAWTFKIPELISLFQRRLLNFVDKTLVEDVIPILQVA
SHSELTQVLDKCIQRIARSNLDDISLDKELSPEVVEEIKKIRKKLQTADDDASISDPVHE
KRVRRIHRALDSDDVELVKLLLNESEITLDDANALHYAASYCDSKVVSELLELGLANLNL
KNSRGYTALHLAAMRREPAIIMCLLNKGATVSQLTADGRSAIGICRRLTRAKDYNTKMEQ
GQESNKDRLCIDILEREMMRNPMSVEDAVTSPLLADDLHMKLLYLENRVALAILFFPAEA
KVAMQIAQADTTEEFGGITAPGTTAPSTSGKLREVDLNETPAIQNKRLRSRVDALMKTVL
THIIWHYAVELGRRYFPNCSQVLDKYLEYKYLEYDLPDGLDQFYLQRGTPDEQKVKRMRF
CELKEDVRKAFTKDKADNSMFSGLSSSSSCSPPQKIAKK
Download sequence
Identical sequences K3XFH8
Si000647m|PACid:19678243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]