SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si000814m|PACid:19676934 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si000814m|PACid:19676934
Domain Number 1 Region: 273-379
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000000497
Family Ankyrin repeat 0.0021
Further Details:      
 
Domain Number 2 Region: 51-195
Classification Level Classification E-value
Superfamily POZ domain 0.0000000863
Family BTB/POZ domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si000814m|PACid:19676934
Sequence length 578
Sequence
MEPMDSQVTAVALSDSDSVSVDGADAADADLQALRRLSDNLAAAFRSPDDFAFLSDARIA
VPGAPDLCVHRCVLCARSPFLRAFFARRTAAAGAGEEKVKDKDKDKDKDKDKDKVELREL
LGEEVEVGYEALRLVIEYLYSGRVGALPKAACLCVDEGGCAHLGCRPAVAFMAQVLFAAS
TFEVAELTSLFQRQLLDVLDKVEVDNLPLILSVANLCSKSCVKLLERCLEIVVRSNLDMI
TLEKALPPDVVKQIVDARLSLELVSPEDKGFPNIHVRRVHRALDSDDVELVRMLLKEGKT
NLDDAYALHYAVEHCDSKITTELLDLALADVNHRNPRGYTVLHIAAMRMEPKIIVSLLTK
GARPSDLTFDHRKAVQISKRLTKHGDYFGPTEDGKPSPKDKLCIEILEQAERRDPQLGEA
SVSLAMAGDCLRGRLLYLENRVALARILFPMEARVAMDIAQVDGTLEFALTVDLNDTPFK
MKEEHLTRMSALSKTVELGKRFFPRCSKVLDQFMDDENELASLGRDTSTSTEKKRRFHDL
QDVLQKAFSEDKEENDRSARSSSVSSRTTSIGAVRPRR
Download sequence
Identical sequences K3XFZ5
Si000814m|PACid:19676934 XP_004968514.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]