SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si005732m|PACid:19704517 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si005732m|PACid:19704517
Domain Number 1 Region: 11-536
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 1.83e-97
Family Acetyl-CoA synthetase-like 0.0000152
Further Details:      
 
Domain Number 2 Region: 759-1062
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 7.06e-37
Family Quinoprotein alcohol dehydrogenase-like 0.0075
Further Details:      
 
Domain Number 3 Region: 549-613
Classification Level Classification E-value
Superfamily ACP-like 0.00000288
Family Peptidyl carrier domain 0.02
Further Details:      
 
Weak hits

Sequence:  Si005732m|PACid:19704517
Domain Number - Region: 1089-1117
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0314
Family Quinoprotein alcohol dehydrogenase-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si005732m|PACid:19704517
Sequence length 1119
Sequence
MAEAEVGAAELCCISHAFDRAARRDPDRLAVIHAPASGGDGEERRFTCADLLAAVASLSR
RIAAAHGGTPTDRLEHPGSRGGGAEPRVVGVHASPSVEYVVAVLAVLRCGEAFLPLDPAW
PEERVSSAVSASNAALVVSSVGSQGAPVFESSPCPVLHLGGDIRQWSRDENGGEDLAWPC
ERDRPRKFCYVMFTSGSTGKPKGVCGTEKDDVLLFKTSISFVDHLQEFLSAALTCTTLVI
PPPSEWRANPASLANLIKVYRISRMTLVPSLMEIILPALAKKLPDGCNPLKILIVSGELL
SVLLWKRVYEVLPETTIINLYGTTEVSGDCTFFDCKDLPTILEREDLNSVPIGFPISNCE
VSLVTEDGLGDEGEISVSGACLFSGYLADPMTSNGLGDNGISAYYKTGDFGRRLKTGELI
FLGRKDRTVKIYGQRFSLEEVESTLREHPDVSDAAVTFQGNGSLDFKAYLVLKSNDEFPK
CYSRLNSSQDIMAPLRSWLIMKLPLAMVPRLFIPMESLPLTLSGKIDYAKLSSLEWALGP
CEIESENSPVDAHMQVIKKAFSDALLVDEVSEYDDFFALGGNSIAAAHVAHKLEIDMRLL
YIYTTPSKLLHALFVESSCVVSPTHEFHNRKRLKVSASISGSFDPVSAHLDNNLHGKGNI
DEEGKHDHFAGNHVNETVGQLNKNMNNDRYRVKDLCSDACLNDGIFSGSPSSPWILNFYL
QKKWSFGRCNRFMHGYEGILKVEDFCTSIPYNKRGYLVKLWDILLDSCVDASPLLVVNNG
MVNIFIGSHSHLFLCIDGCSGSVRWSVKLEGRIECSAAITGDFSEVVIGCYKGKIYFLDM
STGKLSWTFQTDGEVKMQPVVDRTRNLIWCGSYDHYLYALNYKDHCCTYKISCGGSIYGS
PAVDMAQNIIYVASTSGLVAAVSFEEPSFKMIWQYEAGAPIFGSLALDHQSGKVICCLVN
GLVIALNSQGTVIWKAAVGGPIFAGACLSPTLPYQVLIPSRDGSLYSFDIASGALLWVYN
VGDPITASAFVDELLTSESFGPSERFACVCTSSGKVHVIRIRADAKQEQAGRGVKYEQLV
QGLASIDLPGDIFSSPLMIGGRIFVGCRDDRLHCLTVTS
Download sequence
Identical sequences K3XUX5
Si005732m|PACid:19704517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]