SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si008427m|PACid:19704831 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si008427m|PACid:19704831
Domain Number 1 Region: 112-211
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.16e-19
Family B3 DNA binding domain 0.0034
Further Details:      
 
Domain Number 2 Region: 14-99
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000155
Family B3 DNA binding domain 0.01
Further Details:      
 
Weak hits

Sequence:  Si008427m|PACid:19704831
Domain Number - Region: 288-353
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000412
Family B3 DNA binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si008427m|PACid:19704831
Sequence length 353
Sequence
MAPLVRRARPKYAAALLSPTCLHKLRVPGEFAAWLGGEARAAAAVLLVSPLGKVWHADLR
RAGGGGGPGPLQLAGGWAEFAAAHGVRAGWSVVFRLERRGWPPSGRVAAGKNRPRFIRVL
NADDLEKMRIPDEFVQEHLTDTHPSSKRAMIFSPLGKFWRVELDRDQPGVLLGDGWVRFL
TAHDLSEGNILVFRYDDSMVFTVEVFMQSGCLKEYEAATADMTDDAIGRQITVPQQGDKE
LCVSPVKKKRKTRNENTCLAVYRKKPNHSPISVKKAVSQKKLVSIEPRHSFTKRITGYNL
TSLFAVKGSFCSSVGLAGACEITLKTKMGNTRSWRVRFNTTNTYGYITGQGWK
Download sequence
Identical sequences K3Y2K3
Si008427m|PACid:19704831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]