SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si010026m|PACid:19697138 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si010026m|PACid:19697138
Domain Number 1 Region: 385-468
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.42e-16
Family B3 DNA binding domain 0.0048
Further Details:      
 
Domain Number 2 Region: 214-306
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000314
Family B3 DNA binding domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si010026m|PACid:19697138
Sequence length 469
Sequence
MASSGDQWASKAKNPRVLLQFSCDTLVSATNNATAVAPPLTPAAEPTDWLVLAQSPFPSA
SPTSSRRRSVPGRPLSSARRGPAARSRSGPSRSAGTAAARSWAAGGRNSRRPPASRRGGY
SSSATAAAACSPSRRSTPAAASGCSGLPLRLKVTSPTEATGATFYEETEGYTRGSLLLSL
GTGGIRFSNLSPIELIEATVSSRDDARKQQFISAHPTNFMEKMLIPAKFVQQYLPKEHLN
NQSAIVLGPIGKVHSIKLEMGQSDLFFAGGWSQFLAFHDITEANALLLRYEGNMVFTVKI
FGPNGCPIESKHKEVRVPQNIEEQQEAPSASIQKCCENDLPISDGEKKPQGSITSLKKAS
PRVKCIYKIGPPAWIRKEMSTKTIRKYIQPLPAAFCNAIGFQEACTITFKTSLSSTSSWQ
VHVLPYKGSSHQLGSGWRRFCQENKIKEGDVCTFNIIDSTLWHVVIARR
Download sequence
Identical sequences K3Y735
Si010026m|PACid:19697138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]