SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si011696m|PACid:19695044 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si011696m|PACid:19695044
Domain Number 1 Region: 29-95
Classification Level Classification E-value
Superfamily F-box domain 0.000000000000222
Family F-box domain 0.0062
Further Details:      
 
Domain Number 2 Region: 150-369
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.0000114
Family Galactose oxidase, central domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si011696m|PACid:19695044
Sequence length 395
Sequence
MAAATRSHPDLLASSSPGPGEVVADHQALPYIPDDLILAILRRLPAKSVLRFRCVSKAWL
AMLSSRSFVDAHLEFSAAARPTMLIVPGKYHLLDPRRLRTAFWMGFYKYTSGGADTELLH
GERFPGGVASWFKPMHCDGLILVYTRHQELMVCNPATREFVQLLRETERDCLSCLHDAVG
FGRDPRSNTYKVVRLFYSSEHGGGLVNVFSCRAEVLTLGTNQQWRRVATPPRLFNPHPAP
VHVSGFIYWSDVSDPNNLVLLRFNLATETFAATPYPPCKLPGHACLAEWEGELCCFWVPA
PAELVEIWTCDGKADAPTWTRRISVRLPTDTITPGLAYAQGPPTVTFHGKDMLLRGCRKL
YRYSVETEEMKRVAVAVEDLKYDRPVDSDYLQKIS
Download sequence
Identical sequences K3YBV2
Si011696m|PACid:19695044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]