SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si011754m|PACid:19696634 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si011754m|PACid:19696634
Domain Number 1 Region: 25-38,82-126,154-186
Classification Level Classification E-value
Superfamily Tubby C-terminal domain-like 8.37e-36
Family Transcriptional factor tubby, C-terminal domain 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si011754m|PACid:19696634
Sequence length 186
Sequence
MLRPGIAPTENAAPTSREPGGVVPGQPKELLPRLFDESFRSTATSFSKYSIADSSMDLSS
CRYSEFGGGNQRGGGDDDDADKERPLVLCNKASRWHEQLQCCCLNFRGRVTVASVKNFQL
IASAAQAAAAGASAPPARQTPQPQASSSHDTLQRIRSITMDYRYPLSAFQAFAICLTSFD
TKLACE
Download sequence
Identical sequences K3YC10
Si011754m|PACid:19696634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]