SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si012066m|PACid:19694692 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si012066m|PACid:19694692
Domain Number 1 Region: 127-226
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000182
Family B3 DNA binding domain 0.0028
Further Details:      
 
Domain Number 2 Region: 11-68
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000049
Family B3 DNA binding domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si012066m|PACid:19694692
Sequence length 305
Sequence
PEESSGCCFWSHGKIWKIELEINQSDVFFAGGWSQFMVFHGITAANSLLFRYEGNMMFTV
KVFEPNGCQRDSKHKQIGIQQRSTLPNFEKQQEAPSSIKNCKSKSDWPSDERQKIPKGSI
QSKLVYEIGPPSWIKKVIDTNTLENHISLSTAFCDAIGLWGHFTIMLKISINSTQSWKVH
GASYKNSSYTLVLGWKRFFQENNLKEGDICTFNIIKTTLWHVVITRFRENMNQFCYQETP
EREKDWSCSDGQIRPKYSVTYLKQTKTKCVFEIGPPAWIRKEINAITIEKHLVSISIDMS
KLEIW
Download sequence
Identical sequences K3YCW5
Si012066m|PACid:19694692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]