SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si012124m|PACid:19697315 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si012124m|PACid:19697315
Domain Number 1 Region: 84-183
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.16e-16
Family B3 DNA binding domain 0.0083
Further Details:      
 
Domain Number 2 Region: 242-337
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000451
Family B3 DNA binding domain 0.01
Further Details:      
 
Weak hits

Sequence:  Si012124m|PACid:19697315
Domain Number - Region: 47-78
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00353
Family B3 DNA binding domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si012124m|PACid:19697315
Sequence length 340
Sequence
MTSPAAAAQHPRVLLRFTHNTLVRALARSASPRSSPRRSAPTGGRARPWPLGVEWDGEGA
FLGGGWREFAAACGVEPGWDTAHKPQFLRVFPKDFMGKMLIPAKFVQWYIPKEHLLDNHM
AIVSGPLGKVSHVELQMSQSEVFFGGGWSQFLVLHDITESNALLLRYEGNMVFTVKVFEP
DGCQRESKYKDIKMQQSEQKMNNMKRKRENDRSRCEVQKRPKGSMTSSYKASSKAGCIFE
IGPPAWVKKEINTCAIQNSTLYLPPFFCKAIGIWEPCSITLKTSMSSTMSWQARVIPYDH
SSHHVNGLKRFYQDSGIKVGDVCTFIIIETTLWHVVIEPR
Download sequence
Identical sequences K3YD21
Si012124m|PACid:19697315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]