SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si012721m|PACid:19696021 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si012721m|PACid:19696021
Domain Number 1 Region: 103-187
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000018
Family B3 DNA binding domain 0.021
Further Details:      
 
Domain Number 2 Region: 9-88
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000314
Family B3 DNA binding domain 0.01
Further Details:      
 
Weak hits

Sequence:  Si012721m|PACid:19696021
Domain Number - Region: 254-297
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0569
Family B3 DNA binding domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si012721m|PACid:19696021
Sequence length 302
Sequence
MTHLLHSQRIPDELAKGIGTGEARVVGPSGGKVKVWRVEAGRDGDGAFLGRGWPEIAAAF
SVGDRWFLVLQHHGGGILTLKAFDASGCIRGLSTSTYCKDVSHRPQFVSVLPHDFMEKML
IPAKFVEHYIPEEHKNSRMAMVIGSLGKICRVELEMNESNLFLRANALLLKYEGNMVFTV
RVFGPDGFQRDPSLLFSHQASTLPHTAKQQEAPSESIRNHKSKKDWPSREGQKKPKGSTV
SMNEASKRIAVYEIGPPSWIKKEINTCTLRKKLSLSKSFCDAIGLLEPCTITLKTSMNST
ES
Download sequence
Identical sequences K3YEQ5
Si012721m|PACid:19696021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]