SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si016055m|PACid:19689856 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si016055m|PACid:19689856
Domain Number 1 Region: 2334-2624
Classification Level Classification E-value
Superfamily BEACH domain 5.23e-124
Family BEACH domain 0.0000000115
Further Details:      
 
Domain Number 2 Region: 2727-2990
Classification Level Classification E-value
Superfamily WD40 repeat-like 7.33e-37
Family WD40-repeat 0.0085
Further Details:      
 
Domain Number 3 Region: 2165-2206,2248-2312
Classification Level Classification E-value
Superfamily PH domain-like 1.91e-19
Family PreBEACH PH-like domain 0.0068
Further Details:      
 
Domain Number 4 Region: 990-1101
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000224
Family Pentraxin (pentaxin) 0.03
Further Details:      
 
Weak hits

Sequence:  Si016055m|PACid:19689856
Domain Number - Region: 1312-1415,1482-1546
Classification Level Classification E-value
Superfamily ARM repeat 0.000181
Family Armadillo repeat 0.055
Further Details:      
 
Domain Number - Region: 745-930
Classification Level Classification E-value
Superfamily ARM repeat 0.00905
Family Armadillo repeat 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si016055m|PACid:19689856
Sequence length 3006
Sequence
MNIVKGVADLLRKSSPASPGAGGSGGSRGGGDRGGTGSPSADRVAAPPSPRVRFSDSGEE
GVLNALWQKYENAIDKAEKKKSLQIFAMHFIKAFKDWEPGHIEQSVDQESLSDDTVLGCS
TGHPSEVILILIQEISQITSSITETAVVKLKTLTSLLAADEQLSNKTVENMRTMQKVLVY
IVTVISNFMDLEPTTTRISQFLNSSRHALSSNYLATVGPSTSKNMVSDKNWQKKAIVSVM
EAGGVNWLVELLRVIRRLNLKEQWTDLSLHFITLYSLRSTISENTRAQNHFRSIGGLEVL
LDGLGLPSSKFSVSKQSFVPSDERRGILRLQILSLEILREAEFHQQKFLDPQASLKLDKE
STGPSPTLESISNPVDILDASEWNEYSVKLSIALCSFLLPPKEIKYCPAPADVSQISLSI
SLAYWEQCARWIIKVLSTVFPCIKACASETELPNHIRILANTLQHYMLCTFRKVLISAPA
LLKSFREEGLWDLIFSEKFFYFGSSVNYIHQIIHETWNDQLIDAPKSTDSKSFNETDVNI
LQAEAISFLEFAATLNENSNNLPECSALLGALEHCTYDPGLAGAIVKSFHVILQLATEQT
LASFKSINVLTRVLKAACLQAQEVRKLSHPQDDLDQNGSQSRNVLTASSDERIKNACTFV
ELAFNLFKDYVTISDIGRIAVLHNANCIECLFDLFQEEYLRKHIVEQVLALFRLPPSSAQ
DHAAKMHLCSKYLETFTRVKENEKGFAELSIDLLVNMREIIMIDRAYYQNLFRDGECFLH
IVSLLNGTFNEAVGEHLVLNVLQTLTALLAENDESKAAFRLLVGAGYQTLQSLLLDFCKW
IPSPKLLDALLDMLVDGAFDINEKTTIKSSTSLQHYGLMVLQQLLKGSITNRTACFRAGL
LSFLLDWFSVEEGDDIVIKIAELIQIIGGHSISGKDIRKFFALLRGEEIVAKQKHGSLLL
TSVSHMLKEKGPEAFFEFSGHDSSVSPKHQCVLLPLSLPTKQWKFLCVTHTIGRTFSGGS
QLRCYVDGDLVSSEKCRYAKVNEVMTRCSVGTELMPIGEEPSSLGFESTFAFTGQMGPVY
AFSDALSPEQIRGIYNLGPSYMYSFLGDQNLLTNDDSLYKGILDARDGISSKMIFGLNAQ
ASNNRTLFNVSSVLDGPDKSKFEATTMGGTKLCSRRLLQEIIYCVGGVSVFFPLLVHFDD
AVVQNGESAASDELAGMSEVLLKDALSQFYLNPHIWAYATYEVQRELYLFLIQYFEADGK
FLPMLCGLPRIIDVVRQFYSDKVDSRSSKPLLVSKKVIGERPSMEQIRKIRLLLLSLAEM
SLKLKVSQHDIKALVSFLERSQDVACIEDILHMIIRALSQNSLLPSFLEQVNSLGGCYIF
INLLKREFEPIRLLGLQLLGKLLVGVPSEKKGPKIFGLPVGRPRSIAEDIRKGTTAASQL
FFYSISERLFKFPLSDHLCASLFDVLLGGASPKQVLQKRSQSDALKDRSSTSASLAPFFV
PQILVCIFKYIQSCEDASARTKILSDLLDLLDSNPSNVESLMEYGWSSWLETSAKLDVFR
NYKSNSVAKDNGLETNELILVRNMYSLVLSYCIFSVKGGWHQLEDTTNFLLLKIEQGQLP
NSCLLRDIFEDLIGSLLETSSEENVFNSQPCRDNILYLLNLSHELFVDQIGIKLLFPSLD
MSAQLSSNDSLEDDINSAVVEIMNIENNDLVTSLPWSNTLFVNGEKLSDDWWSYFDKIWT
LLCYLNDKGQNRLTPKGSNAAGPSIGQRARGLVESLNIPAAEMAAVVVTGGISSALGGKT
NKIADKAMMLRGERFPRIVFHLIIMYLCKAGLENASKCVQQFISLLPNLISEDDQCKNRL
HFLIWSLLRVRSQYGELDDGARFQVVSHLILETVIYGKSMLATSTLGRDDSTEANSNKEA
GFVLNLVQKDRVLAAATDEVKYMKDATIDRMKLLQELHSKLDERSVQDNERLQSFEDDIQ
FAKTAAISADDNRKAAFQLAFDEDQQIVADKWIHILRALSDERGPWSAAPFPNNIVTYWK
LDKTEDKWRRRLKLKRNYKFDERLCHPSSTKSSNENTAPTVDPSGSTKIPEKLKHLLLKG
VRGITGDINSESFEDNNDTSDSPQTIPPENHPVSDTADSADSDYHAIVQNRKESPTSGDS
DYIEVLSSVHCVLVTPKRKLAGQLTITRNALHFSFEFLVEGTGGSSVFNRFQDRKDSDSK
NEMGGLEKPKANLDGGRGNAAESSDTQIKNQSNKIKHHRRWKITRIKAVHWTRYLLQYTA
TEIFFDDGNAPVFLNFSSQNDAKSVGSLLVSLRNDALFPKGTSRDKNSLISFVDRKVALE
MAESARESWRRREISNFEYLMILNTLAGRSYNDLTQYPTFPWIIADYSSEKLDFNKSSTF
RDLSKPVGALDAKRFKAFEDRYLNFVDPDIPSFYYGSHYSSMGIVLYYLLRLEPFTALHR
NLQGGKFDHADRLFQSIESTYRNCLSNTSDVKELIPEFFYMPEFLENSNSYHLGIKQDGE
PLGDVGLPPWAKGSPEEFIYINREALESEYVSSNLHNWIDLIFGYKQRGKPAVEAANIFY
YLTYEGAVDLENMDDMLQKSAIEDQIANFGQTPIQIFRKKHPRRGPPIPIAHPLYFAPQS
ITVTSVVPTTITPSSVLFIGLLDSNIVLLNEGLILSVKLWLTTQLQSGGNFTFSGSLEPF
FGIGSDVISPRKIGTSLAENVEFGRQCLAAVQIHGDNYLILCGNWENSFQIISLSDGKIV
QSIRQHKDVVSCVAVSSDGSVIATGSYDTTVMIWYAFRGRSNDKRSRNANYDISTKDHVI
IESPSHILCGHDDIITCIFVSTELDIVISGSKDGTCMFHTLCEGTYVRSIRHPSGASLSK
LVTSQHGRLVIYSDSDLSLHMYSINGKHIASSESNSRLSCMELSCCGEFMVCAGDHGQIV
LRSMHSLDVVWRYEGAGKTITSLVVTPEECFLAGTKDGSLIVFSIENPLLRKSTMQRHKA
KPSIGG
Download sequence
Identical sequences K3YP63
Si016055m|PACid:19689856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]