SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si019054m|PACid:19689118 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si019054m|PACid:19689118
Domain Number 1 Region: 2102-2144,2172-2411
Classification Level Classification E-value
Superfamily BEACH domain 5.49e-107
Family BEACH domain 0.0000000349
Further Details:      
 
Domain Number 2 Region: 2519-2609,2645-2696,2732-2758,2797-2863
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.02e-26
Family WD40-repeat 0.0067
Further Details:      
 
Domain Number 3 Region: 1980-2091
Classification Level Classification E-value
Superfamily PH domain-like 1.11e-20
Family PreBEACH PH-like domain 0.0014
Further Details:      
 
Domain Number 4 Region: 288-326,372-513
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000167
Family Clostridium neurotoxins, the second last domain 0.064
Further Details:      
 
Weak hits

Sequence:  Si019054m|PACid:19689118
Domain Number - Region: 625-775,969-1021,1091-1164
Classification Level Classification E-value
Superfamily ARM repeat 0.0224
Family PBS lyase HEAT-like repeat 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si019054m|PACid:19689118
Sequence length 2876
Sequence
RRHFFAFPARPLLLSLPPPLGARPRPCTAPPPLISREHFPKTPTSLLPFGDEAYAVNDEE
VSDTEMSACSPSAPSEPSPPLRRRLAPVVASDVPEEVVRAVDAVIMGGGVEHLREMVSEE
NGEVSHFIVDVLMVTMGGVDGLDEGAGDGLGAATGLPPSIMSSSRAAAIAAELVPYLPCG
VEPSPRTRMARGLLATLSACTRNRTMCSASGLLAVLLDVAEKLFVGMGQGSKWDGTPIVQ
CIQVLGGHSVSVRDLHSWLLLIKKALVTRWATPLTLALENAVASNEAKGPAVTFEFDGES
SGLLGPGDNRWPFSNGFGFATWIYVESFSASLDTDTASAAVAAAAASTSGKSSPSAAAAA
ACTLAGEGTKHMPRLFSFLTSDSHGIETYFNGQFLVVESGAGKGKASLHFTYEFKPRCWY
FVGLEHTSKQALLGKAESELRLYVDGDLHESCPFEPPRIVKPLAFCCIGTNPSPTIAGLQ
RRRRQCPLFAEMGPIYIFTDPIGPERMSRLASRGGDALPSFGNGAGFPWKSTSNHIREAA
EDSYALDIEIGGSLHLLYHPSLLNGRFCSDASPSGSTGTHRRPAEVLGMVHVSHRVRPAE
SLWALAYGGPMALLPLIVSNVEMDNLEPILGDLSLSLATASLSVPIFRIISLAVQHPGNK
DELCRIHGPELLSQVLHYLLDTLSKIESGKKEILSAEELVTAIVSLCQSQRNDHGQKVQL
FSTLLLDLKMWSSCNYFLQKKLLSSLADMVFAESTCMRDANALQMLLDGCRRCYWVIHEA
DSIDTFTLTGHERPLGNVNALVDELLVVIELLIGAAPSTFASDDVRCLVGFVVDCPQPNQ
VARVLLLIYRLIAHPNTSRANLFAQSFISRGVVEALLVLLQREAKSGDSNIFHSSNVPQN
AASWNGSSNLTNKDLELKTANGEESCKDHQIQSVQHQEPTSHETGSGHESTSKWCLLKGQ
FLNNLGGIDVPNISDNVQNSVYNIDGGDGVLVGIVHVLGALVASGHLTFTSSTVRPKLPS
GFLTTCKGEGNTMFEDRVSLLLFALQKAFQAAPKRLMTRNVYRALISSVIDVSSPKDNLK
NLHDSGCHFKHIPLLMVLLCSLPYASRAFQAHAIQDLLYLVCSHPKNRSTMTSISEWPEW
ILEILISNHEDVEAAIHCAEWLSMVGGSSTGDQRIRREESLPIFKRRLLGSLLDFSAQEL
QVQQTGGIAATAAGVAVEDLVPKETKVQAEKAANLSVALAENAIVLMMLVEDHLRSRSQH
FFMSCLVDSAASPASVASLAASRSNSLSRSGSEHLEAGGSRQSLSSDAGGLPVDVLASTA
DTNGQLSAEVMERVTAAAAAEPYGSVRHAFVSYGSCISDLSEGWKYRTRLWYGVCIPPKS
NVFGGGGSGFVSWKSVLEKDSNGNWIELPLVKKSVAMLQALLLDSGLGGCLATGVGSGPG
MGVMGALNQLLDSDQPFFCMLRLILVSMREDDSGEDDIFTRNISMKNEISEGLGCQTGSM
LPLDGHSSASIKKCPAALLWRVLGPILNMPVSETKRQRVLVASSILYSELWHAVSSDRKP
LRKKYVGLIMPPFVAFLKRYRSILAGIHELTSPDAQNPLAVDDWASAADTSPVEVGVSMI
SPGWAAAFASPPVAMALAMIAAGASGTETIAPPTNKLRRRDTSLLERRSAKLHTFSSFQK
PLDTTPSLPTSAPKDKAAAKAAALAAARDLERSAKIGSRRGLSAVAMATSVQRRSAGDIE
RAQRWNTSEAMGAAWMECLQSADSKSVSGRDFSALSYKYVALLVSSFALARNLQRVEMER
RTQVEILNRSCMSIGLRAWRHLLHCLIETSRLYGPFGELLCTPDSIFWKLDLTESSLRMR
RFMKRNYNWLNHLGATANYGEQKFLCDGADSNACHSEDGDSLPTNVLSTSSLITVDGGHE
DIRQGETENICSSVDDQLTNSSPLDQSLTGSVDSRSSDFSGVRNLVRSTVVAPGYRPSNE
RIIIELPSMMIRPLKVVRGTFQVTSKRINFIVDEHTSDSYMDDITSTSGQYDQQDRDRSW
LISSLHQIYSRRYLLRQSALELFMVDRSNFLFDFEDVGARTHAYRAIVHAKPPYLNDIFL
ATQRPEQILKQTQLMERWAKWEISNFEYLMELNTLAGRSYNDITQAFFYYMILSPGSNMF
ATVPYVLYLFLQYPVFPWVIADYKSKTLDLESPSTYRDLSKPIGALNPARLKKFQDHYSS
FKDPIIPKFHYSSHYSSPGTVLYYLSRIEPFSTLSAQLQRAKFDHDDCMFSDVNKTWNSV
LEGLDDVKELVPELFYLPEVFTNLNSSGRLGSVALPPWAENPVDFIHIHRKALESDHVST
HLHEWIDLIFGYKQRGKDAVVANNVFPHVTYDGMVDIDKITDPMQRRATQNQISNFGQTP
SQLLTVPHIRRRTLTEILQVQTIFRNPNEVRSYALPSPDHCNVPASAMLISKDCIVVIDS
NVPTVHVALHHWQPNTPDGLGAPFLFHHGKNAINSSGGAIFRIFKGSSGSTEDYQFPRAV
AFAASAVQNSSAVVVTCDKEVITGRHADNSVKMISPDGARTVETAFGHLAPVTCLALSAD
SNYLVTGSRDTTVILWRIRQVGSSQEKNAPEPPPSTPTTPTSPQATGSSSNSSSSKNLET
YRRRRIEGPMHILRGHLGEVTCCSVSSDLGLVSSSSVSGVLLHSLRTGRLIKKLDVPEAH
SICLSSQGIVLIWNESEKRLSTFTVNGIPIATSVLSPFSGRVSCIETSADGQFAVMGTCS
ASNCNHKGSNATEDDYELDKPCGDEDVQESNETRLSVDAPSICLLDLYKLEVIHTLKLGE
GMDVTALALNKENTTLLVSTADKQLIVFTGPAANNPMSLKVADRSVLHESDGLLKP
Download sequence
Identical sequences K3YXQ8
Si019054m|PACid:19689118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]