SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si021669m|PACid:19701779 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si021669m|PACid:19701779
Domain Number 1 Region: 280-548
Classification Level Classification E-value
Superfamily Tubby C-terminal domain-like 6.54e-92
Family Transcriptional factor tubby, C-terminal domain 0.00000738
Further Details:      
 
Domain Number 2 Region: 219-272
Classification Level Classification E-value
Superfamily F-box domain 0.0000209
Family F-box domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si021669m|PACid:19701779
Sequence length 548
Sequence
MAPGVVVGSGGLGGRGARAGTSRSGRWLVCRAWGADEGERGGPRRGDLSIQLQSPFFSSA
GRALFDAAVLGSLTPKLSSPRRLVATAVRWLDWGVVSSPHYKGHRRGVMYSFFFLDSRLV
FSVNSFSSFLPCSLARFSSLLRSPLYSSPAPLAPIDLLPHLVSKLLDASGGRKSAPGRPT
MVSWRRSASWLSSASRSSLGGAVGGEAKVTPEVGPAAQEEEEVDEERWSRLLPELLTEIV
RRVDAGAERWPLRRDVVVCACVCRRWRDAAFSVVRPPLEGGRITFPSSLKQPGPRDAPMH
CFIRRDKKNSTFSLYLSLTQALTDKGKFLLAARRFRQGAHTEYIISYDYDDLHPGSTSYV
GKLRSDFLGTKFIIYDSQAPYNGAKPSRSRSSRRFTSKQISPQVSGGNYEVGQVTYKFNF
LKSRGPRRMQCSIQCPVGQDTASDPSKEKTPAPCSLDLKNKAPRWHEHLQCWCLNFHGRV
TVASVKNFQLVATAGSGGPWGVGDEETVILQFGKIEDDAFTMDYRQPLSAFQAFAICLTS
FGTKLACE
Download sequence
Identical sequences K3Z551
Si021669m|PACid:19701779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]