SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si022083m|PACid:19698967 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si022083m|PACid:19698967
Domain Number 1 Region: 100-288,330-438
Classification Level Classification E-value
Superfamily Tubby C-terminal domain-like 8.11e-100
Family Transcriptional factor tubby, C-terminal domain 0.0000079
Further Details:      
 
Domain Number 2 Region: 43-95
Classification Level Classification E-value
Superfamily F-box domain 0.000000693
Family F-box domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si022083m|PACid:19698967
Sequence length 438
Sequence
MSFRSMVRDLRESFGNISRRNFEVRIHHRGKSLGSSSDLQDRPVVIQQSRWASLPPELLR
DVMKRLEEDESSWPSRKDVVSCASVCTTWRDMCKDIVRSPEICAKLTFPVSLKQPGPRDG
VIQCFIKRDKSKLTYRLYLCLSSAVLDENGKFLLAAKRSRRTTHTDYAISMDSKNFSRSS
TGYIGKLRSNFLGTKFIIYDTQPPYNAGRLCSQERAPSRRFSSRKVSPKVPIGSYPIAQV
NYELNVLGTRGPRRMQCTMQSIPESAVEPGGVVPGQPKELLPRLFDESFRSTATSLSKYS
IADSSMDLSSCRYSEFGGGNQQGDDNDADKERPLVLRNKAPRWHEQLQCWCLNFRGRVTV
ASVKNFQLIACVAQAAAARASAPPGQTQPQASSSHDTVILQFGKVARDMFTMDYRYPLSA
FQAFAICLTSFDTKLACE
Download sequence
Identical sequences K3Z6B7
XP_004959977.1.39314 Si022083m|PACid:19698967 Si022086m|PACid:19698968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]